# LL-37 — Research Peptide Profile

> The only human cathelicidin — destroys bacterial membranes and cuts biofilm mass 50–80% where antibiotics fail. Mechanism, immune roles & research.

Source: https://peptpedia.org/peptide/ll-37 | Published: 2025-12-02 | Last updated: 2026-08-04

LL-37 is the only cathelicidin antimicrobial peptide produced by humans — a front-line component of innate immunity. It kills bacteria by disrupting their membranes and can penetrate antibiotic-resistant biofilms. Research is preclinical, and therapeutic use is complicated by dose-dependent effects on inflammation.

## Overview

LL-37 is the only human [cathelicidin antimicrobial peptide](/research/ll-37-cathelicidin-innate-immunity-antimicrobial-mechanism), derived from the C-terminus of the precursor protein hCAP18 and produced by neutrophils, macrophages, mast cells, and epithelial cells. It is a first-line [innate immune effector](/compare/thymosin-alpha-1-vs-ll-37) active against Gram-positive bacteria, Gram-negative bacteria, fungi, and enveloped viruses at low micromolar concentrations. Beyond direct membrane disruption, LL-37 modulates immune responses, [promotes wound healing](/compare/bpc-157-vs-ll-37) via EGFR transactivation, and suppresses biofilm formation. Expression is strongly upregulated by vitamin D.

## Molecular Profile

- **Category:** immune-support
- **Molecular formula:** C205H340N60O53
- **Molecular weight:** 4493.33 g/mol
- **CAS number:** 154947-66-7
- **Amino acid sequence:** [LL-37, 37 aa]
- **Also known as:** Cathelicidin, hCAP18, CAP-18
- **Half-life:** Short; susceptible to proteolytic degradation
- **Solubility:** Soluble in water and various buffers
- **Storage:** Store lyophilized at -20°C.

## Mechanism of Action

LL-37 disrupts bacterial membranes through electrostatic interactions with negatively charged components. It also binds and neutralizes bacterial lipopolysaccharide (LPS), modulates cytokine responses, promotes wound healing through effects on epithelial and endothelial cells, and acts as a chemoattractant for immune cells.

## Key Research Findings

- LL-37 is the only cathelicidin antimicrobial peptide produced by humans, making it a cornerstone of the innate immune system's first line of defense against pathogens.
- LL-37 kills bacteria by physically disrupting their cell membranes through electrostatic attraction, a mechanism so fundamental that bacteria have extreme difficulty developing resistance to it.
- LL-37 can penetrate and destroy established bacterial biofilms that are impervious to conventional antibiotics, reducing biofilm mass by 50 to 80 percent in laboratory models.
- Beyond antimicrobial activity, LL-37 serves as a bridge between innate and adaptive immunity by promoting dendritic cell maturation and enhancing antigen presentation to T cells.

## Dosing Information (Research Context)

Research dosages vary widely depending on application. Topical, injection, and nebulized formulations have been studied.

| Route | Dose | Frequency | Notes |
| --- | --- | --- | --- |
| Topical | 0.1–1% solution | 1–2× daily | Wound care and antimicrobial applications |
| Subcutaneous/Intravenous | 1–10 mg | As per research protocol | Systemic immunomodulation research; no standardized human dosing established |

## Researched Effects

- **Antimicrobial Activity** (evidence: extensive): LL-37 demonstrates broad-spectrum antimicrobial peptide activity against gram-positive and gram-negative bacteria, fungi, and enveloped viruses through direct membrane disruption mechanisms that make resistance development extremely difficult. The peptide's cationic nature enables strong electrostatic attraction to negatively charged microbial membranes, where it inserts into the lipid bilayer and creates transmembrane pores that lead to rapid cell lysis and pathogen death. Research has documented minimum inhibitory concentrations (MIC) in the low micromolar range against common pathogens including Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa, and Candida albicans, demonstrating potent antimicrobial efficacy. Studies show LL-37's antimicrobial peptide therapy potential extends to drug-resistant organisms including MRSA and multidrug-resistant gram-negative bacteria, where conventional antibiotics fail. The peptide also demonstrates antiviral activity against influenza, herpes simplex virus, and vaccinia virus through envelope disruption and interference with viral attachment mechanisms. These antimicrobial properties position LL-37 as a crucial research compound for developing novel antimicrobial therapeutic approaches, understanding innate immune defense mechanisms, and combating the growing global antibiotic resistance crisis.
- **Immunomodulation** (evidence: extensive): Research demonstrates LL-37's complex immunomodulatory effects that extend far beyond direct antimicrobial activity, including modulation of pro-inflammatory and anti-inflammatory cytokine production depending on the immunological context and microenvironment. The peptide acts as a chemoattractant for neutrophils, monocytes, and T lymphocytes through formyl peptide receptor-like 1 (FPRL1) activation, enhancing immune cell recruitment to infection sites for improved pathogen clearance. Studies show LL-37 can neutralize bacterial lipopolysaccharide (LPS) and prevent excessive inflammation during gram-negative infections by blocking LPS-induced Toll-like receptor 4 (TLR4) activation and subsequent cytokine storm development. Research indicates the peptide promotes dendritic cell maturation and antigen presentation, bridging innate and adaptive immune system enhancement for comprehensive host defense. In contrast, LL-37 also demonstrates anti-inflammatory properties by promoting regulatory T cell differentiation and IL-10 production in certain contexts, helping resolve inflammation after infection clearance. These immunomodulatory properties make LL-37 valuable for infectious disease research, autoimmune condition investigations, and developing immune-based therapeutic strategies that balance pathogen elimination with inflammation control.
- **Wound Healing Promotion** (evidence: moderate): Research demonstrates LL-37's significant wound healing acceleration properties through promotion of keratinocyte migration, re-epithelialization, and angiogenesis in both acute and chronic wound models. The peptide stimulates epithelial cell proliferation and directional migration through transactivation of the epidermal growth factor receptor (EGFR) pathway, accelerating wound closure by up to 40% in experimental studies. Studies document LL-37's potent angiogenic effects including promotion of endothelial cell proliferation, tubule formation, and VEGF expression, ensuring adequate blood supply to healing tissues for optimal nutrient and oxygen delivery. Research in diabetic wound models demonstrates particular efficacy where impaired healing is associated with reduced endogenous LL-37 expression, suggesting therapeutic potential for chronic wound management studies. The peptide's antimicrobial properties provide additional wound healing benefits by preventing infection that would delay regeneration, creating a dual-action approach to tissue repair. These wound healing properties have significant implications for developing antimicrobial wound dressings, burn treatment studies, and therapeutic approaches for diabetic ulcers and other chronic non-healing wounds.
- **Anti-biofilm Effects** (evidence: moderate): Research demonstrates LL-37's remarkable ability to disrupt established bacterial biofilms and prevent biofilm formation on both biological and medical device surfaces, addressing a critical challenge in infectious disease treatment. Studies show the peptide can reduce biofilm biomass by 50-80% through multiple mechanisms including disruption of the extracellular polymeric matrix, interference with quorum sensing communication between bacteria, and direct killing of biofilm-embedded organisms. Research indicates LL-37 effectively penetrates the protective biofilm structure that shields bacteria from conventional antibiotics, enabling elimination of persistent infections that resist standard antimicrobial therapy. Studies in catheter-associated urinary tract infection models document significant reductions in biofilm formation when surfaces are treated with LL-37, suggesting applications for preventing medical device-related infections. The peptide's anti-biofilm activity extends to dental plaque bacteria, Pseudomonas aeruginosa lung infections in cystic fibrosis, and chronic wound infections where biofilm persistence prevents healing. These anti-biofilm properties position LL-37 as essential research compound for chronic infection treatment development, medical device coating optimization, and understanding the mechanisms by which antimicrobial peptides overcome biofilm-mediated antibiotic resistance.
- **Cancer Research Applications** (evidence: preliminary): Emerging research indicates LL-37 may have direct antitumor effects through selective toxicity to cancer cells, modulation of the tumor microenvironment, and enhancement of anti-tumor immune responses. Studies demonstrate the peptide exhibits cytotoxic activity against various cancer cell lines including colon, breast, and lung cancer cells, with mechanisms involving membrane disruption similar to its antimicrobial activity and induction of apoptosis pathways. Research indicates LL-37 can modulate tumor-associated macrophage polarization and enhance natural killer cell activity against malignant cells, contributing to immune-mediated tumor suppression. However, the relationship between LL-37 and cancer is complex, with some studies suggesting the peptide may promote tumor growth in certain contexts through angiogenesis stimulation and inflammation modulation. These contrasting findings highlight the importance of context-dependent effects and the need for further investigation into LL-37's potential in cancer immunotherapy research, tumor microenvironment modulation, and development of peptide-based anticancer therapeutics.

## Research Applications

- Infectious Disease
- Immunology
- Wound Healing
- Antimicrobial Research
- Cancer Research

## Key Studies

### LL-37, the only human member of the cathelicidin family of antimicrobial peptides

Dürr UH, Sudheendra US, Ramamoorthy A — *Biochimica et Biophysica Acta* (2006) — [PMID 16716248](https://pubmed.ncbi.nlm.nih.gov/16716248/) | [doi:10.1016/j.bbamem.2006.03.030](https://doi.org/10.1016/j.bbamem.2006.03.030)

This comprehensive review analyzes the structure, function, and diverse biological activities of LL-37, the only human cathelicidin antimicrobial peptide, synthesizing decades of research into its role in innate immunity and host defense. The authors present detailed structural analysis showing LL-37 adopts an alpha-helical conformation in membrane-mimetic environments, which is essential for its antimicrobial mechanism of membrane disruption through pore formation and carpet-like dissolution models. The review documents LL-37's remarkable broad-spectrum activity against bacteria, fungi, and viruses, with specific focus on minimum inhibitory concentrations and killing kinetics against clinically relevant pathogens including drug-resistant strains. Beyond direct antimicrobial effects, the authors examine LL-37's complex immunomodulatory functions including chemotaxis, cytokine modulation, wound healing promotion, and angiogenesis stimulation. The review establishes LL-37 as a multifunctional host defense peptide with therapeutic potential for infectious diseases, wound healing applications, and immune system modulation research.

### The cationic antimicrobial peptide LL-37 modulates dendritic cell differentiation and dendritic cell-induced T cell polarization

Davidson DJ, et al. — *Journal of Immunology* (2004) — [PMID 14707090](https://pubmed.ncbi.nlm.nih.gov/14707090/) | [doi:10.4049/jimmunol.172.2.1146](https://doi.org/10.4049/jimmunol.172.2.1146)

This study established LL-37 as a modulator of innate-to-adaptive immune signaling beyond its direct antimicrobial action. LL-37 influenced the differentiation and function of dendritic cells—the antigen-presenting cells that bridge innate and adaptive immunity—altering their surface phenotype, cytokine output, and capacity to polarize T cell responses. By shaping dendritic cell behavior, LL-37 helps direct downstream T cell-mediated immunity, supporting its role as a multifunctional host-defense peptide with immunomodulatory as well as antimicrobial properties.

### Induction of keratinocyte migration via transactivation of the epidermal growth factor receptor by the antimicrobial peptide LL-37

Tokumaru S, Sayama K, et al. — *Journal of Immunology* (2005) — [PMID 16177113](https://pubmed.ncbi.nlm.nih.gov/16177113/) | [doi:10.4049/jimmunol.175.7.4662](https://doi.org/10.4049/jimmunol.175.7.4662)

This study elucidated the molecular mechanisms through which LL-37 promotes wound healing, specifically demonstrating its ability to stimulate keratinocyte migration through transactivation of the epidermal growth factor receptor (EGFR) signaling pathway. Researchers used primary human keratinocytes and wound healing scratch assays to show that LL-37 treatment significantly accelerated wound closure compared to untreated controls, with effects blocked by EGFR inhibitors confirming receptor-dependent mechanisms. The study identified that LL-37 induces matrix metalloproteinase-mediated release of EGFR ligands including heparin-binding EGF-like growth factor, creating an autocrine stimulation loop that drives epithelial cell proliferation and migration. Experiments demonstrated synergistic effects when LL-37 was combined with EGF, suggesting potential for combination approaches in wound healing therapeutics. These mechanistic insights have significant implications for developing LL-37-based wound healing treatments, understanding chronic wound pathophysiology where endogenous LL-37 may be deficient, and designing improved wound dressings incorporating antimicrobial peptide therapy.

## Frequently Asked Questions

### How does LL-37 kill bacteria without causing the same resistance problems as antibiotics?

LL-37 kills bacteria by physically disrupting their cell membranes through electrostatic attraction—the peptide's positive charges bind to negatively charged phospholipids in bacterial membranes, causing pore formation and cell lysis. This mechanism targets the fundamental physical structure of bacterial membranes rather than a specific protein target. Conventional antibiotics target specific enzymes or proteins (e.g., cell wall synthesis enzymes, ribosomes) that can be modified through genetic mutation. Membrane disruption is much harder to evolve resistance to because it would require completely restructuring the bacterial membrane architecture.

### Why does vitamin D affect LL-37 levels?

The LL-37/hCAP18 gene has a vitamin D response element (VDRE) in its promoter region, meaning it is directly transcriptionally regulated by the active form of vitamin D (1,25-dihydroxyvitamin D3). When vitamin D binds to the vitamin D receptor (VDR) in immune cells and epithelial cells, it upregulates LL-37 gene expression. This explains why vitamin D deficiency is associated with increased susceptibility to bacterial infections (particularly respiratory and skin infections) and why vitamin D supplementation improves antimicrobial defense. This LL-37 pathway is one of the best-characterized mechanisms linking vitamin D status to immune function.

### What role does LL-37 play in wound healing?

LL-37 promotes wound healing through multiple mechanisms: it stimulates keratinocyte migration via EGFR (epidermal growth factor receptor) transactivation, accelerating re-epithelialization of wounds; promotes angiogenesis through VEGF upregulation and endothelial cell proliferation; and attracts monocytes and mast cells to wounds as chemoattractants via FPRL1 receptor activation. Research in diabetic wound models is particularly relevant because LL-37 expression is reduced in diabetic tissue, contributing to impaired healing. The antimicrobial activity simultaneously protects wounds from infection while the wound healing properties accelerate closure.

### Is there a relationship between low LL-37 and skin conditions?

Yes. LL-37 expression is significantly dysregulated in several skin conditions. In rosacea, LL-37 is overexpressed and abnormally processed into fragments that trigger inflammation and vascular changes. In atopic dermatitis (eczema), LL-37 is underexpressed, contributing to increased bacterial colonization (particularly S. aureus) and skin barrier dysfunction. In psoriasis, LL-37 forms complexes with self-DNA that activate plasmacytoid dendritic cells through TLR9, initiating the autoimmune cycle. These associations make LL-37 both a therapeutic target and a potential biomarker for multiple dermatological conditions.

### Can LL-37 address antibiotic-resistant bacteria?

LL-37 demonstrates antimicrobial activity against drug-resistant organisms including MRSA (methicillin-resistant Staphylococcus aureus) and multidrug-resistant Gram-negative bacteria in vitro and in animal models. Because its mechanism (membrane disruption) differs fundamentally from antibiotics, it retains activity against bacteria that have developed antibiotic resistance through target mutation. However, some bacteria have evolved partial resistance to LL-37 through mechanisms including electrostatic charge reduction on their membranes. No clinical antibiotic replacement application has been approved to date; LL-37-based therapeutics are in early development stages.

### How does LL-37 interact with LPS (lipopolysaccharide) in Gram-negative infections?

LL-37 directly binds lipopolysaccharide (LPS)—the outer membrane component of Gram-negative bacteria that triggers the septic shock inflammatory cascade via TLR4 on immune cells. By binding and neutralizing LPS before it can activate TLR4, LL-37 can blunt the excessive inflammatory response that causes organ damage in severe Gram-negative sepsis. This endotoxin-neutralizing activity is separate from its direct bactericidal effects and has generated research interest in LL-37-based sepsis interventions, though no approved therapeutic application exists.

### What research exists on LL-37 and lung infections or respiratory disease?

Pulmonary research is one of LL-37's most active areas. LL-37 is secreted by airway epithelial cells and alveolar macrophages and serves as a first-line defense against respiratory pathogens. Studies show: (1) LL-37 is deficient in patients with cystic fibrosis lungs due to proteolytic degradation by Pseudomonas-secreted enzymes; (2) In COVID-19, LL-37 expression correlates inversely with disease severity; (3) LL-37-derived fragments are being developed as inhaled antimicrobials for drug-resistant lung infections. Vitamin D's ability to upregulate LL-37 in respiratory epithelium is proposed as a mechanism underlying vitamin D's protective effect on respiratory tract infections.

### How does LL-37 promote angiogenesis and what are the implications?

LL-37 is a significant angiogenesis promoter—it stimulates VEGF receptor 2 (VEGFR2) phosphorylation, FGF2 release from endothelial cells, and promotes endothelial tube formation in vitro. This angiogenic activity explains its wound healing acceleration and its role in tumor biology (some cancers exploit LL-37 upregulation for neovascularization to support tumor growth). The dual nature—beneficial angiogenesis for wound healing, potentially harmful angiogenesis in cancer—is a fundamental complexity of LL-37 research. In cancer contexts, high LL-37 expression correlates with tumor progression in breast, ovarian, and lung cancers while appearing protective in colon cancer, reflecting the context-dependence of its effects.

## Related Peptides

- [Thymosin Alpha-1](https://peptpedia.org/peptide/thymosin-alpha-1)
- [Thymulin](https://peptpedia.org/peptide/thymulin)
- [KPV](https://peptpedia.org/peptide/kpv)

---

This content is for educational and research purposes only. It is not medical advice, and the compounds covered are research chemicals not approved for human use unless explicitly stated otherwise.

Cite this page: Peptpedia — Research Peptide Encyclopedia, https://peptpedia.org
