# PNC-27 — Research Peptide Profile

> PNC-27 is a 32-aa p53-penetratin peptide that lyses cancer cells via membrane HDM-2 in preclinical models. No human trials; FDA warned about marketed products.

Source: https://peptpedia.org/peptide/pnc-27 | Published: 2026-09-18 | Last updated: 2026-09-18

PNC-27 is an experimental anticancer peptide built from the p53 HDM-2-binding motif (residues 12-26) fused to a membrane-penetrating sequence. In cell and animal models it binds HDM-2 displayed on cancer cell membranes and forms transmembrane pores, causing rapid necrotic death while sparing normal cells that lack surface HDM-2. No human clinical trial results have been published, and in 2017 the FDA warned consumers against PNC-27 products sold as cancer treatments.

## Overview

PNC-27 is a 32-amino acid chimeric peptide created by molecular modeling in the laboratory of Matthew Pincus and Josef Michl at SUNY Downstate Medical Center. It couples the HDM-2-binding domain of the p53 tumor suppressor (residues 12-26) to a cell-penetrating leader derived from the Antennapedia homeodomain. The design premise is unusual: rather than restoring p53 function inside the cell, PNC-27 binds HDM-2 displayed on the outer membrane of cancer cells and assembles transmembrane pores that lyse the cell within hours, a process the research group terms poptosis. Studies from the inventor lineage report activity against pancreatic, breast, melanoma, leukemia, ovarian, and cervical cancer models, while untransformed fibroblasts, lymphocytes, and hematopoietic cells are spared because normal cells do not present HDM-2 on their surface. PNC-27 belongs to the broader class of membrane-active peptides that includes the human cathelicidin [LL-37](/peptide/ll-37), though its selectivity mechanism is target-based rather than charge-based. Nearly all published work originates from one research group with declared patents and an affiliated company, no human trial results exist, and in January 2017 the FDA warned against PNC-27 products marketed as cancer cures after agency testing found bacterial contamination in a sampled inhalation product.

## Molecular Profile

- **Category:** recovery-repair
- **Molecular formula:** C188H293N53O44S
- **Molecular weight:** 4031.73 g/mol
- **CAS number:** 1159861-00-3
- **Amino acid sequence:** PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
- **Also known as:** p53-Penetratin Chimeric Peptide, PNC27
- **Half-life:** Not formally characterized; expected short for an unmodified 32-amino acid peptide
- **Solubility:** Supplied as lyophilized powder; aqueous reconstitution
- **Storage:** Store lyophilized at -20°C or below.

## Mechanism of Action

The p53-derived segment of PNC-27 (residues 12-26) folds into a conformation directly superimposable on p53 bound to HDM-2, allowing the peptide to dock onto HDM-2 anchored in the cancer cell membrane. Immuno-electron microscopy shows PNC-27 and HDM-2 colocalizing in roughly 1:1 ratios within layered ring-shaped pore structures, and these pores drive rapid necrotic death with LDH release rather than caspase-dependent apoptosis. The chimeric linkage is essential: the p53 domain alone, the penetrating leader alone, or the two domains present but unconjugated are all inactive. Because the target is membrane HDM-2 rather than the nuclear p53 pathway, PNC-27 kills cells that express no p53 at all, including the K562 leukemia line. A 2024 study added a second mechanism: after membrane binding, the peptide enters cancer cells and disrupts mitochondrial membranes while sparing lysosomes.

## Key Research Findings

- PNC-27 kills cancer cells by binding HDM-2 displayed on their membranes and forming transmembrane pores; untransformed cells lack surface HDM-2 and are spared in every preclinical study.
- Artificially expressing HDM-2 on the surface of resistant untransformed cells made them susceptible to PNC-27, directly proving the target (PNAS 2010).
- The peptide kills p53-null K562 leukemia cells, confirming its mechanism is independent of cellular p53 status.
- The FDA warned consumers in 2017 not to use PNC-27 products sold as cancer cures after finding bacterial contamination in sampled inhalation solutions.

## Safety & Tolerability

PNC-27 has never been administered to humans in any published study, so its safety profile is unknown. Preclinical work reports a wide selectivity margin between cancer and normal cells, but this comes almost entirely from the inventor group, systematic toxicology has never been published, and the FDA has warned that marketed PNC-27 products were unapproved and, in tested samples, bacterially contaminated.

**Human data status:** No human clinical trials conducted or published; no human pharmacokinetic, dosing, or toxicity data exists. Claims of human use circulating in vendor channels are unverified and carry documented product-quality risk.

**Regulatory status:** Not approved for any use. In January 2017 the FDA publicly warned consumers not to purchase or use PNC-27 sold as a cancer treatment, after agency testing found Variovorax paradoxus in an inhalation solution; a March 2017 update added Ralstonia insidiosa in a second sample.

- Selectivity evidence is in vitro: PNC-27 killed K562 leukemia cells with nearly complete LDH release while normal lymphocytes were unaffected at all tested concentrations; whether an equivalent therapeutic window exists in humans is unproven. (evidence tier: in-vitro; [PMID 25117093](https://pubmed.ncbi.nlm.nih.gov/25117093/))
- In a mouse intraperitoneal ovarian cancer model, adding PNC-27 to weekly paclitaxel reduced tumor growth without reported acute toxicity, but no systematic toxicology (dose-limiting toxicity, organ pathology, immunogenicity) has been published for the peptide. (evidence tier: animal; [PMID 28667027](https://pubmed.ncbi.nlm.nih.gov/28667027/))
- Nearly all PNC-27 research originates from the inventor group with declared patents and an affiliated company, as the authorship of the 2022 mechanism paper illustrates (PMID: 35625682); no independent replication of the in vivo findings is indexed on PubMed, and the FDA contamination findings in marketed product add a documented quality risk to unverified efficacy claims. (evidence tier: theoretical)

## Dosing Information (Research Context)

No human dosing exists. Published work is preclinical: in vitro studies report cancer cell killing at micromolar concentrations (single-digit to roughly 100 micromolar depending on the cell line), and the single in vivo combination study used a mouse intraperitoneal ovarian cancer model with weekly paclitaxel. Dosing schedules circulating in research or vendor communities have no basis in published science.

## Researched Effects

- **Selective Cancer Cell Membranolysis** (evidence: moderate): Across studies from the SUNY Downstate lineage, PNC-27 lysed cancer cell lines from solid and non-solid tumors, including pancreatic (MIA-PaCa-2), breast (MCF-7), melanoma, leukemia (K562, U937, HL60), ovarian, and cervical models, while untransformed control cells were spared. Killing is rapid (on the order of hours), necrotic, and correlates with membrane HDM-2 density. In the landmark PNAS 2010 experiment, untransformed MCF-10-2A cells were resistant to PNC-27 until researchers artificially expressed full-length HDM-2 on their surface, at which point they became susceptible, directly demonstrating that membrane HDM-2 is the selectivity determinant. All evidence is preclinical and largely from one research group.
- **p53-Independent Cytotoxicity** (evidence: moderate): PNC-27 contains a p53 fragment but does not require cellular p53 to kill. The 2014 Annals of Clinical and Laboratory Science study showed nearly complete killing of K562 leukemia cells, which express no p53, with LDH release and colocalization of the peptide with membrane HDM-2 as an early event. This distinguishes PNC-27 from small-molecule MDM2 inhibitors that reactivate the nuclear p53 pathway and suggests applicability, in principle, to the large fraction of human tumors carrying p53 mutations.
- **Sparing of Normal Cells** (evidence: moderate): Untransformed fibroblasts, normal lymphocytes, and normal hematopoietic cells showed no significant toxicity across multiple studies at PNC-27 concentrations that killed cancer cells, a selectivity attributed to the absence of HDM-2 on normal cell surfaces. The 2020 Anticancer Research study extended this to normal hematopoietic cells alongside acute myeloid leukemia lines. Whether this selectivity margin holds in vivo in humans is unknown, since no human exposure has ever been reported.
- **Chemotherapy Combination Synergy** (evidence: preliminary): In ovarian cancer models, ID8 cells that survived paclitaxel treatment showed increased membrane HDM-2 (MDM-2) expression and increased susceptibility to PNC-27. Isobologram analysis of dose combinations indicated synergy between the two agents (combination index below 1), and in a mouse intraperitoneal ovarian cancer model, adding PNC-27 to weekly paclitaxel significantly reduced tumor growth. The finding, from a single 2017 study, suggests PNC-27 could target cells that escape taxane chemotherapy, but it has not been independently replicated.
- **Mitochondrial Membrane Disruption** (evidence: preliminary): A 2024 study reported that after binding membrane HDM-2, PNC-27 enters cancer cells and binds mitochondrial membranes, causing selective mitochondrial disruption: treated cancer cells failed to retain mitotracker dye while their lysosomes retained lysotracker, and immuno-electron microscopy localized gold-labeled peptide to mitochondria. This intracellular second hit may explain the rapidity of killing. The evidence comes from a single study in MIA-PaCa-2 pancreatic carcinoma cells.

## Research Applications

- Oncology Research
- p53 Pathway Biology
- Membrane-Active Peptide Design
- Chemotherapy Resistance Studies

## Key Studies

### Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes

Sarafraz-Yazdi E, Bowne WB, Adler V, et al. — *Proceedings of the National Academy of Sciences* (2010) — [PMID 20080680](https://pubmed.ncbi.nlm.nih.gov/20080680/) | [doi:10.1073/pnas.0909364107](https://doi.org/10.1073/pnas.0909364107)

This landmark PNAS paper established the targeting mechanism of PNC-27. The authors showed that the p53-derived residues of PNC-27 adopt a 3D structure directly superimposable on those residues bound to HDM-2, that significant HDM-2 levels occur in the membranes of multiple cancer cell lines but not untransformed lines, and that PNC-27 colocalizes with membrane-bound HDM-2. The decisive experiment transfected a membrane-targeted full-length HDM-2 construct into untransformed MCF-10-2A cells that are normally resistant to PNC-27: once HDM-2 appeared on their surface, the cells became susceptible to lysis. This demonstrated that membrane HDM-2 is both the target and the determinant of cancer selectivity.

### The anti-cancer peptide, PNC-27, induces tumor cell lysis as the intact peptide

Sookraj KA, Bowne WB, Adler V, et al. — *Cancer Chemotherapy and Pharmacology* (2010) — [PMID 20182728](https://pubmed.ncbi.nlm.nih.gov/20182728/) | [doi:10.1007/s00280-009-1166-7](https://doi.org/10.1007/s00280-009-1166-7)

This structure-activity study tested whether the chimeric architecture of PNC-27 is required for cytotoxicity. Neither the p53 12-26 domain alone, the membrane-penetrating leader alone, nor a mixture of both unconjugated domains reproduced cancer cell killing; only the covalently linked chimeric peptide induced membranolysis, and it remained intact during the process. The work established that PNC-27 functions as an intact fusion peptide rather than as two cooperating fragments, a finding central to understanding its design and to interpreting the activity of related peptides such as PNC-28.

### The anti-cancer peptide, PNC-27, induces tumor cell necrosis of a poorly differentiated non-solid tissue human leukemia cell line that depends on expression of HDM-2 in the plasma membrane of these cells

Davitt K, Babcock BD, Fenelus M, et al. — *Annals of Clinical and Laboratory Science* (2014) — [PMID 25117093](https://pubmed.ncbi.nlm.nih.gov/25117093/)

This study extended PNC-27 research beyond solid tumors to the K562 leukemia line, a poorly differentiated non-solid tumor model with stem-cell-like features that does not express p53. PNC-27, but not the negative control peptide PNC-29, induced nearly 100 percent killing of K562 cells with LDH release and colocalized with HDM-2 in the plasma membrane as an early event, while normal lymphocytes were unaffected at all tested concentrations. Because K562 cells lack p53, the study demonstrated that PNC-27 acts through a p53-independent pathway and suggested that early-developing tumor cells also display targetable membrane HDM-2.

### Synergy between Paclitaxel and Anti-Cancer Peptide PNC-27 in the Treatment of Ovarian Cancer

Alagkiozidis I, Gorelick C, Shah T, et al. — *Annals of Clinical and Laboratory Science* (2017) — [PMID 28667027](https://pubmed.ncbi.nlm.nih.gov/28667027/)

This study asked whether PNC-27 could address chemotherapy escape in ovarian cancer. Paclitaxel produced incomplete, time-dependent killing of ID8 ovarian cancer cells, while PNC-27 produced comprehensive dose-dependent killing that required MDM-2 binding. Cells surviving paclitaxel showed increased membrane MDM-2 expression and increased susceptibility to PNC-27, and isobologram analysis indicated synergy (combination index below 1). In a mouse intraperitoneal ID8 model, adding PNC-27 to weekly paclitaxel significantly reduced tumor growth. The work provides the principal in vivo efficacy dataset for PNC-27 and a mechanistic rationale for combination therapy.

### Targeting Membrane HDM-2 by PNC-27 Induces Necrosis in Leukemia Cells But Not in Normal Hematopoietic Cells

Thadi A, Lewis L, Goldstein E, et al. — *Anticancer Research* (2020) — [PMID 32878773](https://pubmed.ncbi.nlm.nih.gov/32878773/) | [doi:10.21873/anticanres.14488](https://doi.org/10.21873/anticanres.14488)

This study evaluated PNC-27 against human non-stem-cell acute myeloid leukemia lines (U937, OCI-AML3, HL60). Flow cytometry showed high membrane HDM-2 expression on all three lines, and PNC-27 induced necrosis with LDH release within 4 hours. Normal hematopoietic cells were spared. The results replicate the membrane-HDM-2 targeting principle in acute leukemia models and support the reported selectivity margin between malignant and normal blood cells, within the same research lineage's preclinical program.

### Anti-Cancer Peptide PNC-27 Kills Cancer Cells by Unique Interactions with Plasma Membrane-Bound hdm-2 and with Mitochondrial Membranes Causing Mitochondrial Disruption

Krzesaj P, Adler V, Feinman RD, et al. — *Annals of Clinical and Laboratory Science* (2024) — [PMID 38802154](https://pubmed.ncbi.nlm.nih.gov/38802154/)

This study refined the killing mechanism in MIA-PaCa-2 pancreatic carcinoma cells. A monoclonal antibody against the p53-binding site of HDM-2 blocked PNC-27-induced necrosis, confirming engagement of the HDM-2 p53-binding pocket at the membrane. Organelle-specific dye experiments showed that mitochondria of treated cells failed to retain mitotracker while lysosomes retained lysotracker, and immuno-electron microscopy localized gold-labeled anti-PNC-27 antibody to mitochondrial membranes. The authors conclude PNC-27 acts at two levels: transmembrane pore formation at the plasma membrane and selective mitochondrial membrane disruption inside the cell.

## Frequently Asked Questions

### How does PNC-27 distinguish cancer cells from normal cells?

Cancer cells from many tumor types display the HDM-2 oncoprotein on their outer membrane, while untransformed cells do not. PNC-27 binds this surface HDM-2 and assembles transmembrane pores. In the PNAS 2010 study, untransformed MCF-10-2A cells resisted PNC-27 until researchers forced HDM-2 onto their surface, at which point they became susceptible - the clearest demonstration that membrane HDM-2, not some general feature of cancer cells, determines sensitivity.

### Does PNC-27 require p53 to work?

No. Although PNC-27 is built from residues 12-26 of p53, it targets HDM-2 on the cell membrane rather than the nuclear p53 pathway. The 2014 study on K562 leukemia cells, which express no p53 at all, showed nearly complete killing with membrane colocalization of peptide and HDM-2. This makes the mechanism categorically different from MDM2-inhibitor drugs that work by reactivating p53.

### Has PNC-27 been tested in humans?

No peer-reviewed human clinical trial results have been published as of 2026, and no registered trial with reported results could be identified. All efficacy evidence is from cell culture and mouse models, generated almost entirely by the inventor group and its affiliated company (NomoCan Pharmaceuticals), which holds patents on the peptide. References to clinical trials appear in vendor marketing but are unverified.

### What did the FDA warn about PNC-27?

In January 2017 the FDA warned consumers not to buy or use PNC-27, which was being sold online as a cancer treatment or cure. FDA laboratory testing found the bacterium Variovorax paradoxus in a PNC-27 solution intended for inhalation, and a March 2017 update reported Ralstonia insidiosa in another sampled product. The agency stressed the product was unapproved and that contaminated material posed a serious infection risk, especially to immunocompromised patients.

### What is poptosis?

Poptosis is the term the research group uses for the death mechanism induced by PNC-27 and related peptides: peptide-induced formation of transmembrane pores leading to rapid necrotic lysis, as opposed to programmed apoptosis. A 2024 review in Biomedicines formalized the concept, describing pore formation driven by peptide complexes with membrane-bound HDM-2 as a distinct way to kill cancer cells without engaging classical apoptotic machinery.

## Related Peptides

- [LL-37](https://peptpedia.org/peptide/ll-37)
- [FOXO4-DRI](https://peptpedia.org/peptide/foxo4-dri)
- [Adipotide](https://peptpedia.org/peptide/adipotide)

---

This content is for educational and research purposes only. It is not medical advice, and the compounds covered are research chemicals not approved for human use unless explicitly stated otherwise.

Cite this page: Peptpedia — Research Peptide Encyclopedia, https://peptpedia.org
