LL-37 Cathelicidin: Innate Immunity, Amphipathic Helix Antimicrobial Mechanism, and Vitamin D-Regulated Immunomodulation

Cathelicidins are a family of cationic antimicrobial peptides (AMPs) defined by a conserved N-terminal 'cathelin' pro-domain and a structurally diverse C-terminal antimicrobial domain. While most mammals encode multiple cathelicidins (mice have CRAMP; pigs have multiple PR-39 variants), humans encode only a single cathelicidin gene: CAMP (chromosome 3p21.3). The CAMP gene encodes the 18 kDa precursor protein hCAP18 (human cationic antimicrobial protein, 18 kDa).

hCAP18 is stored in the specific granules of neutrophils and in lamellar bodies of keratinocytes in an inactive precursor form. It is activated by proteolytic cleavage that removes the 100-amino acid cathelin pro-domain, releasing the 37-residue C-terminal antimicrobial peptide LL-37. The cleavage enzymes differ by tissue context: neutrophil serine proteases (primarily proteinase 3, elastase) in the inflammatory milieu, and kallikrein-related peptidases (KLK5, KLK7) on skin epithelial surfaces.

Agerberth et al. (1995) first isolated the human cathelicidin gene (originally named FALL-39 for its N-terminal sequence in the original isolation) from bone marrow and testis, establishing it as the human orthologue of previously characterized cathelicidins in other mammals. The mature LL-37 peptide begins with the sequence [LL-37, 37 aa] — the first two residues being leucines (giving rise to the LL-37 nomenclature reflecting both the N-terminal dipeptide LL and the 37-amino acid length).

LL-37 is intrinsically disordered in aqueous solution but rapidly adopts an amphipathic alpha-helical conformation when it encounters the hydrophobic-electrostatic interface of a bacterial membrane. This structural transition is the key to its antimicrobial mechanism — membrane disruption is impossible without the prior folding event that concentrates hydrophobic residues on one face of the helix and cationic (positively charged) residues on the other.

The antimicrobial mechanism proceeds through several steps:

1. Electrostatic targeting: Cationic residues (Arg, Lys, His; net charge +6 at physiological pH) electrostatically attract LL-37 to negatively charged bacterial surfaces — LPS (lipopolysaccharide) and phosphatidylglycerol/cardiolipin in gram-negative outer membranes; teichoic acids and negatively charged lipids in gram-positive membranes. Mammalian cell membranes, composed predominantly of zwitterionic phosphatidylcholine and sphingomyelin, do not present the same electrostatic target, providing selectivity.
2. Amphipathic helix insertion: After surface binding, the hydrophobic face of the helix inserts into the lipid bilayer's hydrophobic core while the cationic face interacts with the negatively charged headgroups.
3. Membrane disruption: At high local concentrations (achieved during neutrophil degranulation or epithelial secretion), LL-37 disrupts membrane integrity through 'toroidal pore' formation or 'carpet model' detergent-like membrane solubilization, depending on membrane composition and peptide:lipid ratio. The result is loss of membrane potential, leakage of intracellular contents, and bacterial cell death.

Dürr et al. (2006) provided a comprehensive biophysical analysis of LL-37-membrane interactions using solid-state NMR and circular dichroism, confirming the alpha-helical adoption in membrane environments and quantifying the amphipathic geometry. The helix begins forming at residues 2–31 (the canonical antimicrobial core), with the N-terminal LL and C-terminal residues (32–37) contributing less to the helical structure but influencing oligomeric behavior and potency.

Beyond direct antimicrobial activity, LL-37 has extensive immunomodulatory effects that position it as a bridge between innate and adaptive immunity. These functions operate through distinct receptors and signaling pathways from the membrane-disruption mechanism:

FPR2/FPRL-1 receptor signaling: LL-37 acts as an agonist at the formyl peptide receptor 2 (FPR2, also called FPRL-1 or ALX) expressed on neutrophils, macrophages, mast cells, and epithelial cells. FPR2 is a Gαi-coupled GPCR that mediates chemotaxis, calcium mobilization, and ROS production in neutrophils — effects that amplify the antimicrobial response. Importantly, FPR2 also mediates pro-resolution signals, and LL-37 at different concentrations can have either pro-inflammatory (at low concentrations) or anti-inflammatory (at high concentrations) effects through FPR2, suggesting context-dependent immunomodulation.

TLR4 modulation: LL-37 binds LPS and prevents LPS-TLR4 interactions, reducing pro-inflammatory cytokine release (TNF-α, IL-6, IL-12) during gram-negative bacterial infection. This 'LPS scavenging' function is critically important for preventing endotoxin-mediated septic shock — LL-37 deficient states (e.g., in vitamin D deficiency or Kostmann syndrome) are associated with higher susceptibility to severe bacterial infection and dysregulated inflammatory responses.

Chemokine induction: LL-37 directly stimulates epithelial cells, keratinocytes, and macrophages to produce IL-8 (CXCL8), MCP-1 (CCL2), and IP-10 (CXCL10), recruiting additional neutrophils and monocytes to sites of infection. Lehrer and Ganz (2002) reviewed these immunostimulatory functions of cathelicidins in the context of their broader roles in innate host defense, establishing the dual antimicrobial/immunomodulatory framework that characterizes cathelicidin biology.

LL-37 plays significant roles in wound healing beyond its antimicrobial barrier function. In the skin, LL-37 released from damaged keratinocytes activates epithelial repair mechanisms through several convergent pathways:

EGFR transactivation: LL-37 activates the epidermal growth factor receptor (EGFR) in keratinocytes through matrix metalloproteinase (MMP)-dependent shedding of heparin-binding EGF (HB-EGF), driving keratinocyte migration and proliferation necessary for re-epithelialization. This pathway links antimicrobial peptide release directly to wound closure kinetics.

Angiogenesis: LL-37 is a potent inducer of angiogenesis through VEGF-dependent and VEGF-independent pathways. It stimulates VEGF-A expression in endothelial cells and directly promotes endothelial proliferation and tube formation. The FPR2-mediated angiogenic pathway operates independently of VEGF, providing redundancy in the pro-angiogenic response to tissue injury.

Fibroblast activation: LL-37 stimulates dermal fibroblast migration and collagen production through FPR2 and purinergic receptor activation, contributing to the remodeling phase of wound healing.

These wound healing roles are context-dependent and concentration-sensitive. At physiological concentrations in intact skin (typically 1–2 μg/mL in sweat), LL-37 primarily provides antimicrobial barrier function. At higher concentrations in damaged tissue (10–100 μg/mL in wound fluid), the immunomodulatory and repair-promoting effects dominate. This concentration-response relationship has been exploited in research protocols investigating LL-37 as a therapeutic agent for chronic non-healing wounds where both infection control and repair stimulation are needed.

One of the most clinically significant features of LL-37 biology is its tight regulation by vitamin D — specifically 1,25-dihydroxyvitamin D3 (calcitriol), the active hormonal form. The CAMP gene promoter contains a functional vitamin D response element (VDRE) that is directly transactivated by the vitamin D receptor (VDR)/RXR heterodimer, making CAMP gene expression exquisitely sensitive to vitamin D status.

When macrophages or monocytes encounter mycobacterial lipoproteins through TLR1/2 signaling, they upregulate the 25-hydroxyvitamin D3-1α-hydroxylase enzyme (CYP27B1), converting circulating 25(OH)D3 to active 1,25(OH)2D3 locally. This autocrine/paracrine vitamin D activation then drives CAMP transcription in the same cells, producing LL-37 to kill the bacteria. This elegant feedback circuit directly links vitamin D status to antimicrobial competence: individuals with 25(OH)D3 serum levels below ~75 nmol/L fail to activate this pathway adequately, producing insufficient LL-37 and showing increased susceptibility to respiratory pathogens including Mycobacterium tuberculosis, influenza, and SARS-CoV-2.

This vitamin D-LL-37 axis provides a plausible mechanistic explanation for the consistently observed epidemiological associations between vitamin D deficiency and susceptibility to respiratory tract infections — a relationship that became intensely studied during the COVID-19 pandemic. Multiple clinical studies examining the relationship between vitamin D status, LL-37/cathelicidin levels, and COVID-19 severity were published, collectively suggesting that maintaining adequate vitamin D status ≥75–125 nmol/L optimizes cathelicidin-mediated innate defense without supplementation reaching potentially harmful supraphysiological levels.